$ cat recipes/summit-holiday-brazilian-garlic-butter-overnight-oat-bake-050659.md

Summit Holiday Brazilian Garlic Butter Overnight Oat Bake No. 050659

Name: Summit Holiday Brazilian Garlic Butter Overnight Oat Bake No. 050659
Prep time: 26 min
Cook time: 36 min
Total time: 62 min
Yield: 5 servings
Ingredients: summit holiday brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Holiday Brazilian Garlic Butter Overnight Oat Bake No. 050659 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Holiday Brazilian Garlic Butter Overnight Oat Bake No. 050659

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       26 min
cook       36 min
total      62 min
servings   5
protein    27 g
pantry     65/100

categorybreakfastdietpescatarianleveleasykcal286

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit holiday brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.