$ cat recipes/summit-holiday-french-sweet-potato-egg-hash-056894.md

Summit Holiday French Sweet Potato Egg Hash No. 056894

Name: Summit Holiday French Sweet Potato Egg Hash No. 056894
Prep time: 9 min
Cook time: 19 min
Total time: 28 min
Yield: 5 servings
Ingredients: summit holiday french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Summit Holiday French Sweet Potato Egg Hash No. 056894 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Summit Holiday French Sweet Potato Egg Hash No. 056894

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       9 min
cook       19 min
total      28 min
servings   5
protein    42 g
pantry     98/100

categorybreakfastdietpescatarianleveleasykcal191

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit holiday french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.