$ cat recipes/summit-holiday-indian-tomato-basil-smoothie-plate-059664.md

Summit Holiday Indian Tomato Basil Smoothie Plate No. 059664

Name: Summit Holiday Indian Tomato Basil Smoothie Plate No. 059664
Prep time: 25 min
Cook time: 29 min
Total time: 54 min
Yield: 5 servings
Ingredients: summit holiday indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Summit Holiday Indian Tomato Basil Smoothie Plate No. 059664 is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Holiday Indian Tomato Basil Smoothie Plate No. 059664

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       25 min
cook       29 min
total      54 min
servings   5
protein    22 g
pantry     64/100

categorybreakfastdietpescatarianleveleasykcal271

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit holiday indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.