$ cat recipes/summit-holiday-japanese-garlic-butter-pancake-stack-058479.md

Summit Holiday Japanese Garlic Butter Pancake Stack No. 058479

Name: Summit Holiday Japanese Garlic Butter Pancake Stack No. 058479
Prep time: 12 min
Cook time: 18 min
Total time: 30 min
Yield: 5 servings
Ingredients: summit holiday japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Holiday Japanese Garlic Butter Pancake Stack No. 058479 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Holiday Japanese Garlic Butter Pancake Stack No. 058479

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       12 min
cook       18 min
total      30 min
servings   5
protein    25 g
pantry     67/100

categorybreakfastdietpescatarianlevelmediumkcal526

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit holiday japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.