$ cat recipes/summit-late-night-japanese-lemon-herb-egg-stack-059379.md

Summit Late-Night Japanese Lemon Herb Egg Stack No. 059379

Name: Summit Late-Night Japanese Lemon Herb Egg Stack No. 059379
Prep time: 6 min
Cook time: 10 min
Total time: 16 min
Yield: 5 servings
Ingredients: summit late-night japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Late-Night Japanese Lemon Herb Egg Stack No. 059379 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Summit Late-Night Japanese Lemon Herb Egg Stack No. 059379

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       6 min
cook       10 min
total      16 min
servings   5
protein    41 g
pantry     86/100

categorybreakfastdietpescatarianleveleasykcal506

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit late-night japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.