$ cat recipes/summit-late-night-ontario-miso-scallion-egg-muffin-plate-050069.md

Summit Late-Night Ontario Miso Scallion Egg Muffin Plate No. 050069

Name: Summit Late-Night Ontario Miso Scallion Egg Muffin Plate No. 050069
Prep time: 16 min
Cook time: 10 min
Total time: 26 min
Yield: 5 servings
Ingredients: summit late-night ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Late-Night Ontario Miso Scallion Egg Muffin Plate No. 050069 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Summit Late-Night Ontario Miso Scallion Egg Muffin Plate No. 050069

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       16 min
cook       10 min
total      26 min
servings   5
protein    41 g
pantry     94/100

categorybreakfastdietpescatarianleveleasykcal506

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit late-night ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.