$ cat recipes/summit-late-night-taiwanese-sesame-ginger-scramble-bake-056304.md

Summit Late-Night Taiwanese Sesame Ginger Scramble Bake No. 056304

Name: Summit Late-Night Taiwanese Sesame Ginger Scramble Bake No. 056304
Prep time: 21 min
Cook time: 31 min
Total time: 52 min
Yield: 5 servings
Ingredients: summit late-night taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Summit Late-Night Taiwanese Sesame Ginger Scramble Bake No. 056304 is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

runnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Late-Night Taiwanese Sesame Ginger Scramble Bake No. 056304

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       21 min
cook       31 min
total      52 min
servings   5
protein    18 g
pantry     86/100

categorybreakfastdietpescatarianleveleasykcal411

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit late-night taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.