$ cat recipes/summit-lunchbox-mexican-corn-pepper-oat-plate-051269.md

Summit Lunchbox Mexican Corn Pepper Oat Plate No. 051269

Name: Summit Lunchbox Mexican Corn Pepper Oat Plate No. 051269
Prep time: 8 min
Cook time: 12 min
Total time: 20 min
Yield: 5 servings
Ingredients: summit lunchbox mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Lunchbox Mexican Corn Pepper Oat Plate No. 051269 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Summit Lunchbox Mexican Corn Pepper Oat Plate No. 051269

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       8 min
cook       12 min
total      20 min
servings   5
protein    37 g
pantry     92/100

categorybreakfastdietpescatarianlevelmediumkcal316

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit lunchbox mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.