$ cat recipes/summit-lunchbox-ontario-pesto-kale-smoothie-cup-059189.md

Summit Lunchbox Ontario Pesto Kale Smoothie Cup No. 059189

Name: Summit Lunchbox Ontario Pesto Kale Smoothie Cup No. 059189
Prep time: 8 min
Cook time: 10 min
Total time: 18 min
Yield: 5 servings
Ingredients: summit lunchbox ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Lunchbox Ontario Pesto Kale Smoothie Cup No. 059189 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Summit Lunchbox Ontario Pesto Kale Smoothie Cup No. 059189

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       8 min
cook       10 min
total      18 min
servings   5
protein    41 g
pantry     87/100

categorybreakfastdietpescatarianleveleasykcal336

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit lunchbox ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.