$ cat recipes/summit-market-day-indian-garlic-butter-pancake-stack-051479.md

Summit Market-Day Indian Garlic Butter Pancake Stack No. 051479

Name: Summit Market-Day Indian Garlic Butter Pancake Stack No. 051479
Prep time: 22 min
Cook time: 38 min
Total time: 60 min
Yield: 5 servings
Ingredients: summit market-day indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Market-Day Indian Garlic Butter Pancake Stack No. 051479 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Market-Day Indian Garlic Butter Pancake Stack No. 051479

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       22 min
cook       38 min
total      60 min
servings   5
protein    23 g
pantry     65/100

categorybreakfastdietpescatarianlevelmediumkcal246

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit market-day indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.