$ cat recipes/summit-market-day-korean-sweet-potato-egg-muffin-stack-051079.md

Summit Market-Day Korean Sweet Potato Egg Muffin Stack No. 051079

Name: Summit Market-Day Korean Sweet Potato Egg Muffin Stack No. 051079
Prep time: 10 min
Cook time: 12 min
Total time: 22 min
Yield: 5 servings
Ingredients: summit market-day korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Market-Day Korean Sweet Potato Egg Muffin Stack No. 051079 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Summit Market-Day Korean Sweet Potato Egg Muffin Stack No. 051079

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       12 min
total      22 min
servings   5
protein    37 g
pantry     93/100

categorybreakfastdietpescatarianleveleasykcal636

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit market-day korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.