$ cat recipes/summit-rainy-day-british-sesame-ginger-egg-bake-059854.md

Summit Rainy-Day British Sesame Ginger Egg Bake No. 059854

Name: Summit Rainy-Day British Sesame Ginger Egg Bake No. 059854
Prep time: 23 min
Cook time: 29 min
Total time: 52 min
Yield: 5 servings
Ingredients: summit rainy-day british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Summit Rainy-Day British Sesame Ginger Egg Bake No. 059854 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Rainy-Day British Sesame Ginger Egg Bake No. 059854

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       29 min
total      52 min
servings   5
protein    22 g
pantry     63/100

categorybreakfastdietpescatarianleveleasykcal441

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit rainy-day british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.