$ cat recipes/summit-rainy-day-mexican-coconut-lime-breakfast-wrap-cup-051234.md

Summit Rainy-Day Mexican Coconut Lime Breakfast Wrap Cup No. 051234

Name: Summit Rainy-Day Mexican Coconut Lime Breakfast Wrap Cup No. 051234
Prep time: 13 min
Cook time: 33 min
Total time: 46 min
Yield: 5 servings
Ingredients: summit rainy-day mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Summit Rainy-Day Mexican Coconut Lime Breakfast Wrap Cup No. 051234 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Rainy-Day Mexican Coconut Lime Breakfast Wrap Cup No. 051234

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       13 min
cook       33 min
total      46 min
servings   5
protein    14 g
pantry     76/100

categorybreakfastdietpescatarianlevelmediumkcal491

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit rainy-day mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.