$ cat recipes/summit-rainy-day-mexican-sweet-potato-scramble-hash-055899.md

Summit Rainy-Day Mexican Sweet Potato Scramble Hash No. 055899

Name: Summit Rainy-Day Mexican Sweet Potato Scramble Hash No. 055899
Prep time: 16 min
Cook time: 8 min
Total time: 24 min
Yield: 5 servings
Ingredients: summit rainy-day mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Rainy-Day Mexican Sweet Potato Scramble Hash No. 055899 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Rainy-Day Mexican Sweet Potato Scramble Hash No. 055899

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       16 min
cook       8 min
total      24 min
servings   5
protein    7 g
pantry     59/100

categorybreakfastdietpescatarianleveleasykcal616

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit rainy-day mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.