$ cat recipes/summit-rainy-day-ontario-tomato-basil-pancake-cup-056489.md

Summit Rainy-Day Ontario Tomato Basil Pancake Cup No. 056489

Name: Summit Rainy-Day Ontario Tomato Basil Pancake Cup No. 056489
Prep time: 26 min
Cook time: 34 min
Total time: 60 min
Yield: 5 servings
Ingredients: summit rainy-day ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Rainy-Day Ontario Tomato Basil Pancake Cup No. 056489 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerathleterunnerhousehold-of-4pescatarianhigh-proteingluten-freehalal-friendly

Recipe report: Summit Rainy-Day Ontario Tomato Basil Pancake Cup No. 056489

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       26 min
cook       34 min
total      60 min
servings   5
protein    31 g
pantry     71/100

categorybreakfastdietpescatarianleveleasykcal396

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit rainy-day ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.