$ cat recipes/summit-rainy-day-taiwanese-sesame-ginger-yogurt-cup-hash-050949.md

Summit Rainy-Day Taiwanese Sesame Ginger Yogurt Cup Hash No. 050949

Name: Summit Rainy-Day Taiwanese Sesame Ginger Yogurt Cup Hash No. 050949
Prep time: 16 min
Cook time: 14 min
Total time: 30 min
Yield: 5 servings
Ingredients: summit rainy-day taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Rainy-Day Taiwanese Sesame Ginger Yogurt Cup Hash No. 050949 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Summit Rainy-Day Taiwanese Sesame Ginger Yogurt Cup Hash No. 050949

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       16 min
cook       14 min
total      30 min
servings   5
protein    33 g
pantry     98/100

categorybreakfastdietpescatarianleveleasykcal236

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit rainy-day taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.