$ cat recipes/summit-spring-indian-lemon-herb-breakfast-wrap-cup-058739.md

Summit Spring Indian Lemon Herb Breakfast Wrap Cup No. 058739

Name: Summit Spring Indian Lemon Herb Breakfast Wrap Cup No. 058739
Prep time: 22 min
Cook time: 14 min
Total time: 36 min
Yield: 5 servings
Ingredients: summit spring indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Spring Indian Lemon Herb Breakfast Wrap Cup No. 058739 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Summit Spring Indian Lemon Herb Breakfast Wrap Cup No. 058739

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       22 min
cook       14 min
total      36 min
servings   5
protein    33 g
pantry     98/100

categorybreakfastdietpescatarianleveleasykcal346

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit spring indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.