$ cat recipes/summit-spring-indian-miso-scallion-egg-muffin-plate-050514.md

Summit Spring Indian Miso Scallion Egg Muffin Plate No. 050514

Name: Summit Spring Indian Miso Scallion Egg Muffin Plate No. 050514
Prep time: 9 min
Cook time: 9 min
Total time: 18 min
Yield: 5 servings
Ingredients: summit spring indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Summit Spring Indian Miso Scallion Egg Muffin Plate No. 050514 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Spring Indian Miso Scallion Egg Muffin Plate No. 050514

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       9 min
cook       9 min
total      18 min
servings   5
protein    24 g
pantry     69/100

categorybreakfastdietpescatarianleveleasykcal311

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit spring indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.