$ cat recipes/summit-summer-indian-sweet-potato-egg-muffin-stack-055079.md

Summit Summer Indian Sweet Potato Egg Muffin Stack No. 055079

Name: Summit Summer Indian Sweet Potato Egg Muffin Stack No. 055079
Prep time: 20 min
Cook time: 44 min
Total time: 64 min
Yield: 5 servings
Ingredients: summit summer indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Summer Indian Sweet Potato Egg Muffin Stack No. 055079 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Summer Indian Sweet Potato Egg Muffin Stack No. 055079

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       20 min
cook       44 min
total      64 min
servings   5
protein    11 g
pantry     59/100

categorybreakfastdietpescatarianleveleasykcal656

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit summer indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.