$ cat recipes/summit-summer-korean-garlic-butter-egg-muffin-plate-051019.md

Summit Summer Korean Garlic Butter Egg Muffin Plate No. 051019

Name: Summit Summer Korean Garlic Butter Egg Muffin Plate No. 051019
Prep time: 6 min
Cook time: 10 min
Total time: 16 min
Yield: 5 servings
Ingredients: summit summer korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Summer Korean Garlic Butter Egg Muffin Plate No. 051019 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Summit Summer Korean Garlic Butter Egg Muffin Plate No. 051019

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       6 min
cook       10 min
total      16 min
servings   5
protein    41 g
pantry     89/100

categorybreakfastdietpescatarianleveleasykcal376

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit summer korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.