$ cat recipes/summit-summer-mexican-garlic-butter-overnight-oat-bake-057659.md

Summit Summer Mexican Garlic Butter Overnight Oat Bake No. 057659

Name: Summit Summer Mexican Garlic Butter Overnight Oat Bake No. 057659
Prep time: 16 min
Cook time: 16 min
Total time: 32 min
Yield: 5 servings
Ingredients: summit summer mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Summer Mexican Garlic Butter Overnight Oat Bake No. 057659 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Summit Summer Mexican Garlic Butter Overnight Oat Bake No. 057659

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       16 min
cook       16 min
total      32 min
servings   5
protein    29 g
pantry     67/100

categorybreakfastdietpescatarianleveleasykcal566

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit summer mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.