$ cat recipes/summit-summer-taiwanese-sweet-potato-oat-bake-057259.md

Summit Summer Taiwanese Sweet Potato Oat Bake No. 057259

Name: Summit Summer Taiwanese Sweet Potato Oat Bake No. 057259
Prep time: 26 min
Cook time: 28 min
Total time: 54 min
Yield: 5 servings
Ingredients: summit summer taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Summer Taiwanese Sweet Potato Oat Bake No. 057259 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Summit Summer Taiwanese Sweet Potato Oat Bake No. 057259

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       26 min
cook       28 min
total      54 min
servings   5
protein    43 g
pantry     95/100

categorybreakfastdietpescatarianleveleasykcal466

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit summer taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.