$ cat recipes/summit-sunday-brazilian-coconut-lime-smoothie-hash-050694.md

Summit Sunday Brazilian Coconut Lime Smoothie Hash No. 050694

Name: Summit Sunday Brazilian Coconut Lime Smoothie Hash No. 050694
Prep time: 21 min
Cook time: 15 min
Total time: 36 min
Yield: 5 servings
Ingredients: summit sunday brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Summit Sunday Brazilian Coconut Lime Smoothie Hash No. 050694 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Sunday Brazilian Coconut Lime Smoothie Hash No. 050694

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       21 min
cook       15 min
total      36 min
servings   5
protein    12 g
pantry     81/100

categorybreakfastdietpescatarianleveleasykcal601

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit sunday brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.