$ cat recipes/summit-sunday-japanese-coconut-lime-yogurt-cup-plate-053969.md

Summit Sunday Japanese Coconut Lime Yogurt Cup Plate No. 053969

Name: Summit Sunday Japanese Coconut Lime Yogurt Cup Plate No. 053969
Prep time: 12 min
Cook time: 26 min
Total time: 38 min
Yield: 5 servings
Ingredients: summit sunday japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Sunday Japanese Coconut Lime Yogurt Cup Plate No. 053969 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Sunday Japanese Coconut Lime Yogurt Cup Plate No. 053969

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       12 min
cook       26 min
total      38 min
servings   5
protein    9 g
pantry     67/100

categorybreakfastdietpescatarianleveleasykcal256

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit sunday japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.