$ cat recipes/summit-sunday-taiwanese-miso-scallion-scramble-cup-051889.md

Summit Sunday Taiwanese Miso Scallion Scramble Cup No. 051889

Name: Summit Sunday Taiwanese Miso Scallion Scramble Cup No. 051889
Prep time: 20 min
Cook time: 20 min
Total time: 40 min
Yield: 5 servings
Ingredients: summit sunday taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Sunday Taiwanese Miso Scallion Scramble Cup No. 051889 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Sunday Taiwanese Miso Scallion Scramble Cup No. 051889

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       20 min
cook       20 min
total      40 min
servings   5
protein    21 g
pantry     65/100

categorybreakfastdietpescatarianleveleasykcal226

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit sunday taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.