$ cat recipes/summit-sunday-taiwanese-spinach-feta-breakfast-wrap-stack-052779.md

Summit Sunday Taiwanese Spinach Feta Breakfast Wrap Stack No. 052779

Name: Summit Sunday Taiwanese Spinach Feta Breakfast Wrap Stack No. 052779
Prep time: 6 min
Cook time: 18 min
Total time: 24 min
Yield: 5 servings
Ingredients: summit sunday taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Sunday Taiwanese Spinach Feta Breakfast Wrap Stack No. 052779 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Sunday Taiwanese Spinach Feta Breakfast Wrap Stack No. 052779

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       6 min
cook       18 min
total      24 min
servings   5
protein    25 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal326

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit sunday taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.