$ cat recipes/summit-winter-indian-sweet-potato-smoothie-plate-059614.md

Summit Winter Indian Sweet Potato Smoothie Plate No. 059614

Name: Summit Winter Indian Sweet Potato Smoothie Plate No. 059614
Prep time: 7 min
Cook time: 21 min
Total time: 28 min
Yield: 5 servings
Ingredients: summit winter indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Summit Winter Indian Sweet Potato Smoothie Plate No. 059614 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Summit Winter Indian Sweet Potato Smoothie Plate No. 059614

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       7 min
cook       21 min
total      28 min
servings   5
protein    38 g
pantry     88/100

categorybreakfastdietpescatarianleveleasykcal381

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit winter indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.