$ cat recipes/summit-winter-korean-sweet-potato-yogurt-cup-cup-057434.md

Summit Winter Korean Sweet Potato Yogurt Cup Cup No. 057434

Name: Summit Winter Korean Sweet Potato Yogurt Cup Cup No. 057434
Prep time: 23 min
Cook time: 37 min
Total time: 60 min
Yield: 5 servings
Ingredients: summit winter korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Summit Winter Korean Sweet Potato Yogurt Cup Cup No. 057434 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Summit Winter Korean Sweet Potato Yogurt Cup Cup No. 057434

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       37 min
total      60 min
servings   5
protein    44 g
pantry     93/100

categorybreakfastdietpescatarianleveleasykcal571

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit winter korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.