$ cat recipes/summit-winter-ontario-spinach-feta-breakfast-wrap-stack-053779.md

Summit Winter Ontario Spinach Feta Breakfast Wrap Stack No. 053779

Name: Summit Winter Ontario Spinach Feta Breakfast Wrap Stack No. 053779
Prep time: 14 min
Cook time: 26 min
Total time: 40 min
Yield: 5 servings
Ingredients: summit winter ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Winter Ontario Spinach Feta Breakfast Wrap Stack No. 053779 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Winter Ontario Spinach Feta Breakfast Wrap Stack No. 053779

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       14 min
cook       26 min
total      40 min
servings   5
protein    9 g
pantry     68/100

categorybreakfastdietpescatarianleveleasykcal576

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit winter ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.