$ cat recipes/summit-winter-ontario-spinach-feta-oat-stack-058229.md

Summit Winter Ontario Spinach Feta Oat Stack No. 058229

Name: Summit Winter Ontario Spinach Feta Oat Stack No. 058229
Prep time: 10 min
Cook time: 16 min
Total time: 26 min
Yield: 5 servings
Ingredients: summit winter ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Winter Ontario Spinach Feta Oat Stack No. 058229 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Summit Winter Ontario Spinach Feta Oat Stack No. 058229

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       16 min
total      26 min
servings   5
protein    29 g
pantry     64/100

categorybreakfastdietpescatarianleveleasykcal586

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit winter ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.