$ cat recipes/summit-winter-taiwanese-coconut-lime-breakfast-wrap-cup-052789.md

Summit Winter Taiwanese Coconut Lime Breakfast Wrap Cup No. 052789

Name: Summit Winter Taiwanese Coconut Lime Breakfast Wrap Cup No. 052789
Prep time: 14 min
Cook time: 12 min
Total time: 26 min
Yield: 5 servings
Ingredients: summit winter taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Winter Taiwanese Coconut Lime Breakfast Wrap Cup No. 052789 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Summit Winter Taiwanese Coconut Lime Breakfast Wrap Cup No. 052789

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       14 min
cook       12 min
total      26 min
servings   5
protein    37 g
pantry     84/100

categorybreakfastdietpescatarianleveleasykcal206

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit winter taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.