$ cat recipes/summit-winter-taiwanese-sweet-potato-egg-hash-051894.md

Summit Winter Taiwanese Sweet Potato Egg Hash No. 051894

Name: Summit Winter Taiwanese Sweet Potato Egg Hash No. 051894
Prep time: 13 min
Cook time: 17 min
Total time: 30 min
Yield: 5 servings
Ingredients: summit winter taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Summit Winter Taiwanese Sweet Potato Egg Hash No. 051894 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

runnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Winter Taiwanese Sweet Potato Egg Hash No. 051894

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       13 min
cook       17 min
total      30 min
servings   5
protein    8 g
pantry     79/100

categorybreakfastdietpescatarianleveleasykcal411

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit winter taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.