$ cat recipes/sunday-french-coconut-lime-egg-muffin-bake-4059.md

Sunday French Coconut Lime Egg Muffin Bake

Name: Sunday French Coconut Lime Egg Muffin Bake
Prep time: 14 min
Cook time: 28 min
Total time: 42 min
Yield: 5 servings
Ingredients: sunday french coconut; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Sunday French Coconut Lime Egg Muffin Bake is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Sunday French Coconut Lime Egg Muffin Bake

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       14 min
cook       28 min
total      42 min
servings   5
protein    43 g
pantry     88/100

categorybreakfastdietpescatarianleveleasykcal396

$ price recipe --region auto

Estimating local basket...

Ingredients

sunday french coconut
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.