$ cat recipes/sunday-japanese-coconut-lime-pancake-plate-3964.md

Sunday Japanese Coconut Lime Pancake Plate

Name: Sunday Japanese Coconut Lime Pancake Plate
Prep time: 15 min
Cook time: 9 min
Total time: 24 min
Yield: 5 servings
Ingredients: sunday japanese coconut; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Sunday Japanese Coconut Lime Pancake Plate is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Sunday Japanese Coconut Lime Pancake Plate

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       15 min
cook       9 min
total      24 min
servings   5
protein    24 g
pantry     68/100

categorybreakfastdietpescatarianleveleasykcal311

$ price recipe --region auto

Estimating local basket...

Ingredients

sunday japanese coconut
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.