$ cat recipes/sunday-mediterranean-garlic-butter-toast-plate-3569.md

Sunday Mediterranean Garlic Butter Toast Plate

Name: Sunday Mediterranean Garlic Butter Toast Plate
Prep time: 18 min
Cook time: 18 min
Total time: 36 min
Yield: 5 servings
Ingredients: sunday mediterranean garlic; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Sunday Mediterranean Garlic Butter Toast Plate is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Sunday Mediterranean Garlic Butter Toast Plate

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       18 min
cook       18 min
total      36 min
servings   5
protein    25 g
pantry     69/100

categorybreakfastdietpescatarianleveleasykcal396

$ price recipe --region auto

Estimating local basket...

Ingredients

sunday mediterranean garlic
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.