$ cat recipes/sunday-mexican-miso-scallion-egg-muffin-plate-3069.md

Sunday Mexican Miso Scallion Egg Muffin Plate

Name: Sunday Mexican Miso Scallion Egg Muffin Plate
Prep time: 14 min
Cook time: 14 min
Total time: 28 min
Yield: 5 servings
Ingredients: sunday mexican miso; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Sunday Mexican Miso Scallion Egg Muffin Plate is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Sunday Mexican Miso Scallion Egg Muffin Plate

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       14 min
cook       14 min
total      28 min
servings   5
protein    33 g
pantry     63/100

categorybreakfastdietpescatarianleveleasykcal516

$ price recipe --region auto

Estimating local basket...

Ingredients

sunday mexican miso
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.