$ cat recipes/sunday-mexican-spinach-feta-yogurt-cup-bake-4959.md

Sunday Mexican Spinach Feta Yogurt Cup Bake

Name: Sunday Mexican Spinach Feta Yogurt Cup Bake
Prep time: 8 min
Cook time: 20 min
Total time: 28 min
Yield: 5 servings
Ingredients: sunday mexican spinach; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Sunday Mexican Spinach Feta Yogurt Cup Bake is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Sunday Mexican Spinach Feta Yogurt Cup Bake

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       8 min
cook       20 min
total      28 min
servings   5
protein    21 g
pantry     66/100

categorybreakfastdietpescatarianleveleasykcal376

$ price recipe --region auto

Estimating local basket...

Ingredients

sunday mexican spinach
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.