$ cat recipes/sunday-ontario-garlic-butter-smoothie-bake-4654.md

Sunday Ontario Garlic Butter Smoothie Bake

Name: Sunday Ontario Garlic Butter Smoothie Bake
Prep time: 17 min
Cook time: 13 min
Total time: 30 min
Yield: 5 servings
Ingredients: sunday ontario garlic; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Sunday Ontario Garlic Butter Smoothie Bake is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Sunday Ontario Garlic Butter Smoothie Bake

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       17 min
cook       13 min
total      30 min
servings   5
protein    16 g
pantry     73/100

categorybreakfastdietpescatarianleveleasykcal361

$ price recipe --region auto

Estimating local basket...

Ingredients

sunday ontario garlic
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.