$ cat recipes/winter-indian-sweet-potato-overnight-oat-plate-4164.md

Winter Indian Sweet Potato Overnight Oat Plate

Name: Winter Indian Sweet Potato Overnight Oat Plate
Prep time: 21 min
Cook time: 41 min
Total time: 62 min
Yield: 5 servings
Ingredients: winter indian sweet; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Winter Indian Sweet Potato Overnight Oat Plate is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Winter Indian Sweet Potato Overnight Oat Plate

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       21 min
cook       41 min
total      62 min
servings   5
protein    36 g
pantry     95/100

categorybreakfastdietpescatarianleveleasykcal361

$ price recipe --region auto

Estimating local basket...

Ingredients

winter indian sweet
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.