$ cat recipes/winter-japanese-spinach-feta-scramble-plate-4869.md

Winter Japanese Spinach Feta Scramble Plate

Name: Winter Japanese Spinach Feta Scramble Plate
Prep time: 24 min
Cook time: 36 min
Total time: 60 min
Yield: 5 servings
Ingredients: winter japanese spinach; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Winter Japanese Spinach Feta Scramble Plate is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Winter Japanese Spinach Feta Scramble Plate

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       24 min
cook       36 min
total      60 min
servings   5
protein    27 g
pantry     60/100

categorybreakfastdietpescatarianleveleasykcal476

$ price recipe --region auto

Estimating local basket...

Ingredients

winter japanese spinach
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.