$ cat recipes/winter-mediterranean-lemon-herb-yogurt-cup-plate-4464.md

Winter Mediterranean Lemon Herb Yogurt Cup Plate

Name: Winter Mediterranean Lemon Herb Yogurt Cup Plate
Prep time: 19 min
Cook time: 13 min
Total time: 32 min
Yield: 5 servings
Ingredients: winter mediterranean lemon; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Winter Mediterranean Lemon Herb Yogurt Cup Plate is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Winter Mediterranean Lemon Herb Yogurt Cup Plate

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       19 min
cook       13 min
total      32 min
servings   5
protein    16 g
pantry     74/100

categorybreakfastdietpescatarianleveleasykcal191

$ price recipe --region auto

Estimating local basket...

Ingredients

winter mediterranean lemon
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.