$ cat recipes/winter-taiwanese-sesame-ginger-smoothie-stack-3674.md

Winter Taiwanese Sesame Ginger Smoothie Stack

Name: Winter Taiwanese Sesame Ginger Smoothie Stack
Prep time: 25 min
Cook time: 31 min
Total time: 56 min
Yield: 5 servings
Ingredients: winter taiwanese sesame; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Winter Taiwanese Sesame Ginger Smoothie Stack is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Winter Taiwanese Sesame Ginger Smoothie Stack

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       25 min
cook       31 min
total      56 min
servings   5
protein    18 g
pantry     76/100

categorybreakfastdietpescatarianleveleasykcal361

$ price recipe --region auto

Estimating local basket...

Ingredients

winter taiwanese sesame
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.