$ cat recipes/juniper-spring-taiwanese-spinach-feta-overnight-oat-cup-073689.md

Juniper Spring Taiwanese Spinach Feta Overnight Oat Cup No. 073689

Name: Juniper Spring Taiwanese Spinach Feta Overnight Oat Cup No. 073689
Prep time: 14 min
Cook time: 12 min
Total time: 26 min
Yield: 5 servings
Ingredients: juniper spring taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Spring Taiwanese Spinach Feta Overnight Oat Cup No. 073689 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Juniper Spring Taiwanese Spinach Feta Overnight Oat Cup No. 073689

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       14 min
cook       12 min
total      26 min
servings   5
protein    37 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal286

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper spring taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.