$ cat recipes/lantern-spring-ontario-coconut-lime-oat-cup-033784.md

Lantern Spring Ontario Coconut Lime Oat Cup

Name: Lantern Spring Ontario Coconut Lime Oat Cup
Prep time: 23 min
Cook time: 15 min
Total time: 38 min
Yield: 5 servings
Ingredients: lantern spring ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lantern Spring Ontario Coconut Lime Oat Cup is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Lantern Spring Ontario Coconut Lime Oat Cup

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       15 min
total      38 min
servings   5
protein    12 g
pantry     88/100

categorybreakfastdietpescatarianleveleasykcal661

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

lantern spring ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.