$ cat recipes/orchard-rainy-day-mediterranean-tomato-basil-scramble-hash-080849.md

Orchard Rainy-Day Mediterranean Tomato Basil Scramble Hash No. 080849

Name: Orchard Rainy-Day Mediterranean Tomato Basil Scramble Hash No. 080849
Prep time: 22 min
Cook time: 10 min
Total time: 32 min
Yield: 5 servings
Ingredients: orchard rainy-day mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Rainy-Day Mediterranean Tomato Basil Scramble Hash No. 080849 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Rainy-Day Mediterranean Tomato Basil Scramble Hash No. 080849

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       22 min
cook       10 min
total      32 min
servings   5
protein    41 g
pantry     96/100

categorybreakfastdietpescatarianleveleasykcal606

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard rainy-day mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.