$ cat recipes/signal-summer-british-coconut-lime-egg-muffin-bake-097059.md

Signal Summer British Coconut Lime Egg Muffin Bake No. 097059

Name: Signal Summer British Coconut Lime Egg Muffin Bake No. 097059
Prep time: 10 min
Cook time: 12 min
Total time: 22 min
Yield: 5 servings
Ingredients: signal summer british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Signal Summer British Coconut Lime Egg Muffin Bake No. 097059 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Signal Summer British Coconut Lime Egg Muffin Bake No. 097059

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       12 min
total      22 min
servings   5
protein    37 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal616

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

signal summer british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.