$ cat recipes/summit-holiday-indian-tomato-basil-overnight-oat-plate-059669.md

Summit Holiday Indian Tomato Basil Overnight Oat Plate No. 059669

Name: Summit Holiday Indian Tomato Basil Overnight Oat Plate No. 059669
Prep time: 18 min
Cook time: 26 min
Total time: 44 min
Yield: 5 servings
Ingredients: summit holiday indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Holiday Indian Tomato Basil Overnight Oat Plate No. 059669 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Holiday Indian Tomato Basil Overnight Oat Plate No. 059669

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       18 min
cook       26 min
total      44 min
servings   5
protein    9 g
pantry     78/100

categorybreakfastdietpescatarianlevelmediumkcal456

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit holiday indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.