$ cat recipes/summit-spring-mexican-spinach-feta-egg-plate-050319.md

Summit Spring Mexican Spinach Feta Egg Plate No. 050319

Name: Summit Spring Mexican Spinach Feta Egg Plate No. 050319
Prep time: 18 min
Cook time: 12 min
Total time: 30 min
Yield: 5 servings
Ingredients: summit spring mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Summit Spring Mexican Spinach Feta Egg Plate No. 050319 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Summit Spring Mexican Spinach Feta Egg Plate No. 050319

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       18 min
cook       12 min
total      30 min
servings   5
protein    37 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal446

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit spring mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.