$ cat recipes/summit-winter-mediterranean-tomato-basil-egg-muffin-stack-053574.md

Summit Winter Mediterranean Tomato Basil Egg Muffin Stack No. 053574

Name: Summit Winter Mediterranean Tomato Basil Egg Muffin Stack No. 053574
Prep time: 15 min
Cook time: 35 min
Total time: 50 min
Yield: 5 servings
Ingredients: summit winter mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Summit Winter Mediterranean Tomato Basil Egg Muffin Stack No. 053574 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Summit Winter Mediterranean Tomato Basil Egg Muffin Stack No. 053574

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       15 min
cook       35 min
total      50 min
servings   5
protein    10 g
pantry     68/100

categorybreakfastdietpescatarianleveleasykcal341

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

summit winter mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.